PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s0204.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 625aa    MW: 70826.1 Da    PI: 6.6176
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s0204.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.11.9e-24115216199
                          EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                          f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF 
  Bostr.7867s0204.1.p 115 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL 202
                          88****************************9643..445569************************************************ PP

                          E-SSSEE..EEEEE-S CS
                   B3  84 ldgrsefelvvkvfrk 99 
                            + +++el+v+v+r+
  Bostr.7867s0204.1.p 203 --RGENGELRVGVRRA 216
                          ..449999******97 PP

2Auxin_resp1125.6e-37241320183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a ha++ k++F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtv+gv+d++p +W++SkWr+L+
  Bostr.7867s0204.1.p 241 ACHATQAKTMFIVYYKPRT--SQFIISLNKYLEAMNNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSP-HWKDSKWRCLE 320
                          6799**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.54E-39106244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-41108230IPR015300DNA-binding pseudobarrel domain
CDDcd100177.36E-21113215No hitNo description
PROSITE profilePS5086312.731115217IPR003340B3 DNA binding domain
PfamPF023623.5E-22115216IPR003340B3 DNA binding domain
SMARTSM010194.6E-24115217IPR003340B3 DNA binding domain
PfamPF065075.1E-33241319IPR010525Auxin response factor
PfamPF023095.6E-8501558IPR033389AUX/IAA domain
SuperFamilySSF542779.16E-13517598No hitNo description
PROSITE profilePS5174525.41522622IPR000270PB1 domain
PfamPF023091.9E-6567610IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MANHGGEYLY DELWKLCAGP LVDVPQAEER VYYFPQGHME QLEASTQQDL NTRKPLFDLP  60
PKILCNVVNV RLQAEKDTDE VYAQITLIPV GTEVDEPMTP DPSPPETQKP KFHSFSKVLT  120
ASDTSTHGGF SVLRKHATEC LPPLDMTQQT PTQELVAEDV HGYQWKFKHI FRGQPRRHLL  180
TTGWSTFVTS KRLVAGDTFV FLRGENGELR VGVRRANRHQ SSMPSSVISS HSMHLGVLAT  240
ACHATQAKTM FIVYYKPRTS QFIISLNKYL EAMNNKFSVG MRFKMRFEGE DSPERRYSGT  300
VIGVKDCSPH WKDSKWRCLE VHWDEPASIP RPDKVSPWEI EPFVTSESVH QSVMLKNKRP  360
RQVSEVSALD VGITASNLWS SVLTQSHEFA QSCITSQRSS SQQCYRDSTE DAKKSEWLNN  420
SYSVSNVSKD STLNDQMVSP VEQKKPETIA NYRLFGIDLM SSSLAASEEK NAPMRPINIT  480
KPTLDSNSDP KSEISKVSEE KKQEPAQTSP KEVQSKQSSS TRSRTKVQMQ GVPVGRAVDL  540
TTLNGYNELI DDLEKLFDIK GELRSRNQWE IVFTDDEGDM MLVGDDPWPE FCNMVKRIFI  600
WSKEEVKKMT PGNQLRMLLT EVET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-162934319355Auxin response factor 1
4ldw_A1e-162934319355Auxin response factor 1
4ldv_A1e-162934319355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010448630.10.0PREDICTED: auxin response factor 9 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLD7M8Z20.0D7M8Z2_ARALL; Auxin response factor
TrEMBLR0F8V90.0R0F8V9_9BRAS; Auxin response factor (Fragment)
STRINGAT4G23980.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9